SHB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SHB Polyclonal antibody (31967-1-AP)

SHB Polyclonal Antibody for WB, ELISA

Cat No. 31967-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SH2 domain-containing adapter protein B

• 

  WB analysis using 31967-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31967-1-AP (SHB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SHB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HUVEC cells, L02 cells, C2C12 cells, H9C2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31967-1-AP targets SHB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35936

  Product name: Recombinant human SHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 214-375 aa of BC136581

  Sequence: ACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLR

• Full Name: Src homology 2 domain containing adaptor protein B
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC136581
• Gene Symbol: SHB
• Gene ID (NCBI): 6461
• RRID: AB_3742501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q15464
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SH2 domain-containing adapter protein B (SHB) is an adaptor protein that operates downstream of tyrosine kinases. It is crucial in various cellular responses, including cell survival, differentiation, and proliferation (PMID: 29792386). SHB is involved in the modulation of focal adhesion kinase (FAK) signaling, which is important for regulating cell cycle progression in hematopoietic stem cells (PMID: 23528453). The protein has also been implicated in the progression of myeloproliferative disorders by affecting the activity of FAK and other signaling intermediates (PMID: 24952416).

Publications

What published studies show

The SHB Polyclonal antibody (Cat# 31967-1-AP) has 2 citations. They appear in Journal of Biological Chemistry and Cell Chemical Biology. The cited research fields include tyrosine kinase signaling and cell proliferation (VEGFR2/IQGAP1 pathway) and chemical proteomics (cysteine-engagement profiling by a lysis-derived oxidant). The antibody was used in Western blot applications with human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Tyrosine phosphorylation of the scaffold protein IQGAP1 by VEGFR2 modulates cell proliferation.; Authors - Mohammed Rizwan Babu Sait
		Cell Chem Biol; A lysis-derived PMSF and orthovanadate oxidant defines a distinct cysteine-engagement profile.; Authors - Bethany E. Schaffer