SHCBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SHCBP1 Polyclonal antibody (12672-1-AP)

• Featured Product
• KD/KO Validated

SHCBP1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12672-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

PAL, SHCBP1

• 

  WB analysis of Neuro-2a using 12672-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 12672-1-AP (SHCBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12672-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12672-1-AP (SHCBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12672-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12672-1-AP (SHCBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12672-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12672-1-AP (SHCBP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12672-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12672-1-AP (SHCBP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Sp2/0 using 12672-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 12672-1-AP (SHCBP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 12672-1-AP

  IP result of anti-SHCBP1 (IP:12672-1-AP, 4ug; Detection:12672-1-AP 1:500) with Jurkat cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12672-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12672-1-AP (SHCBP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12672-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12672-1-AP (SHCBP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 12672-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 12672-1-AP (SHCBP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 12672-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 12672-1-AP (SHCBP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12672-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 12672-1-AP (SHCBP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12672-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 12672-1-AP (SHCBP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SHCBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, Sp2/0 cells, Neuro-2a cells, HepG2 cells, mouse thymus tissue
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human liver cancer tissue, human tonsillitis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12672-1-AP targets SHCBP1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3355

  Product name: Recombinant human SHCBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 374-672 aa of BC030699

  Sequence: NACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF

• Full Name: SHC SH2-domain binding protein 1
• Calculated Molecular Weight: 672 aa, 76 kDa
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: BC030699
• Gene Symbol: SHCBP1
• Gene ID (NCBI): 79801
• RRID: AB_10639526
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SHCBP1 was initially identified as a potential gene associated with cell proliferation in fibroblasts. SHCBP1 exerts a crucial physiological function in normal tissue development. Chen et al. showed that SHCBP1 is an essential component of FGF signaling in neural progenitor cells. SHCBP1 is also upregulated during T cell proliferation and regulates CD4+ T cell effector function in vivo. Recently, SHCBP1 was shown to be closely associated with cancer development.

Publications

What published studies show

The anti-SHCBP1 antibody (Cat# 12672-1-AP) has 20 citations. These appear in journals including Cancer Research, Nature Neuroscience, Molecular Cell, Journal of Experimental & Clinical Cancer Research, MedComm, Apoptosis, FEBS Journal, Journal of Virology, Genomics, Molecular Carcinogenesis, Frontiers in Oncology, and others. Research fields span oncology (tumor progression, metastasis, drug resistance), neurobiology, virology, immunology, and pharmacology.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; Targeting SHCBP1 Inhibits Tumor Progression by Restoring Ciliogenesis in Ductal Carcinoma; Authors - Wengui Shi
mouse	WB	Nat Neurosci; Impaired neurogenesis alters brain biomechanics in a neuroprogenitor-based genetic subtype of congenital hydrocephalus.; Authors - Phan Q Duy
human	WB	Mol Cell; An interactome-based framework for DDB1- and CUL4-associated factor prioritization in targeted protein degradation.; Authors - Satoshi Yamanaka
human	IF,IHC, WB	J Exp Clin Cancer Res; SHCBP1 promotes synovial sarcoma cell metastasis via targeting TGF-β1/Smad signaling pathway and is associated with poor prognosis.; Authors - Changliang Peng ; KD Validated
human	WB,IHC,IF,CoIP	MedComm (2020); SHCBP1 is a novel regulator of PLK1 phosphorylation and promotes prostate cancer bone metastasis; Authors - Chen Tang ; KD Validated
human	WB	Apoptosis; SHCBP1 promotes cisplatin resistance of ovarian cancer through AKT/mTOR/Autophagy pathway; Authors - Gonghua Qi ; KD Validated