SHH Recombinant monoclonal antibody, PBS Only

SHH Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86106-1-PBS
Clone No.250549A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

EC:3.1.-.-, HHG 1, HHG1, HHG-1, HLP3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86106-1-PBS targets SHH in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4010

Product name: recombinant human SHH protein

Source: mammalian cells-derived, pHZ-KIsec-C-mFc

Tag: C-mFc

Domain: 24-197 aa of NM_000193

Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Predict reactive species
Full Name sonic hedgehog homolog (Drosophila)
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50-60 kDa
GenBank Accession NumberNM_000193
Gene Symbol SHH
Gene ID (NCBI) 6469
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15465
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SHH, also named as HHG-1, belongs to the hedgehog family. SHH binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. It regulates another target, the gli oncogene. The Shh protein is synthesized as a 45-kDa precursor that undergoes an autocatalytic processing event that produces a 19-kDa N-terminal product, responsible for all signaling activities, and a 25-kDa C-terminal fragment (PMID:10753901, PMID: 16282375). SHH can be detected precursor protein as 48-51-kDa polypeptides (PMID: 15292211).

Loading...
||
New chat Able
正在加载,请稍候...