SHH Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 86106-1-RR (same clone as 86106-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 86106-1-RR (SHH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86106-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 86106-1-RR (same clone as 86106-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 86106-1-RR (SHH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86106-1-PBS in a different storage buffer formulation.

SHH Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86106-1-PBS

Clone No.250549A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:3.1.-.-, HHG 1, HHG1, HHG-1, HLP3

---

Product Information

86106-1-PBS targets SHH in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4010

  Product name: recombinant human SHH protein

  Source: mammalian cells-derived, pHZ-KIsec-C-mFc

  Tag: C-mFc

  Domain: 24-197 aa of NM_000193

  Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

• Full Name: sonic hedgehog homolog (Drosophila)
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: NM_000193
• Gene Symbol: SHH
• Gene ID (NCBI): 6469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15465
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SHH, also named as HHG-1, belongs to the hedgehog family. SHH binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. It regulates another target, the gli oncogene. The Shh protein is synthesized as a 45-kDa precursor that undergoes an autocatalytic processing event that produces a 19-kDa N-terminal product, responsible for all signaling activities, and a 25-kDa C-terminal fragment (PMID:10753901, PMID: 16282375). SHH can be detected precursor protein as 48-51-kDa polypeptides (PMID: 15292211).