SHISA8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SHISA8 Polyclonal antibody (30240-1-AP)

• 

  IHC staining of human lung using 30240-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 30240-1-AP (SHISA8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 30240-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 30240-1-AP (SHISA8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SHISA8 Polyclonal Antibody for IHC, ELISA

Cat No. 30240-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IHC, ELISA

Synonyms

C22-CTA-250D10.9, C22orf17, LOC440829, Putative protein shisa 8, SHISA8, transmembrane protein 46 like

---

Tested Applications

• Positive IHC detected in: human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30240-1-AP targets SHISA8 in IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31420

  Product name: Recombinant human SHISA8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-300 aa of NM_001353438

  Sequence: RLGLERAHSPRARRTVTRALTELLKQPGPQEPLPPTLGPPLGGCVQVQMGDGLPRGSPHNSADKKRLNNAPRGSAAPGPPRGPRLQGGGSLTLQPDYAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSP

• Full Name: transmembrane protein 46-like
• Calculated Molecular Weight: 42KD
• GenBank Accession Number: NM_001353438
• Gene Symbol: SHISA8
• Gene ID (NCBI): 440829
• RRID: AB_3086274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: B8ZZ34
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The least studied AMPAR-interacting member of the Shisa protein family is SHISA8 (CKAMP39). In HEK293 cells, SHISA8 significantly affected AMPAR-mediated current kinetics, such as current amplitude, as well as AMPAR desensitization and recovery from desensitization (PMID:33892364).