Use Able AI chat for product recommendations

SHLD1 Polyclonal antibody, PBS Only

SHLD1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24347-1-PBS
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

C20orf196, FAM35A, RINN1-REV7-interacting novel NHEJ regulator 3, RINN3, Shield complex subunit 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SHLD1 in ?

Product Information

24347-1-PBS targets SHLD1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19727

Product name: Recombinant human C20orf196 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-141 aa of BC035800

Sequence: MAARDATSGSLSEESSALDLPSACDIRDYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPDTSNLNIEQNNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQESQKYA

Predict reactive species
Full Name chromosome 20 open reading frame 196
Calculated Molecular Weight 205 aa, 23 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC035800
Gene Symbol C20orf196
Gene ID (NCBI) 149840
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IYI0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SHLD1, also known as FAM35A, is a key protein in the field of DNA damage repair. As a core component of the Shieldin complex, SHLD1 plays a critical role in maintaining genomic stability. Its primary function is to inhibit the resection of DNA double-strand break ends, directing repair toward the non-homologous end joining pathway while suppressing accurate homologous recombination repair. This function makes SHLD1 an important target for cancer therapy. In BRCA-mutant tumors, the expression level of SHLD1 directly affects the efficacy of PARP inhibitors-intact SHLD1 function renders cancer cells sensitive to the drugs, while its loss leads to drug resistance. Therefore, SHLD1 is not only a fundamental element in basic research on DNA damage response mechanisms but also a highly valuable tumor biomarker and prognostic indicator, offering new directions for personalized cancer treatment.

Loading...
||
New chat

Able™

正在加载,请稍候...