SHOC2/Sur-8 Recombinant monoclonal antibody

• 

  WB analysis using 84917-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84917-5-RR (SHOC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

SHOC2/Sur-8 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84917-5-RR

Clone No.242343E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

SHOC2, sur-8, KIAA0862, Leucine-rich repeat protein SHOC-2, Protein soc 2 homolog

---

Tested Applications

• Positive WB detected in: Jurkat cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84917-5-RR targets SHOC2/Sur-8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11754

  Product name: Recombinant human SHOC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 235-583 aa of BC050445

  Sequence: GELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV

• Full Name: soc-2 suppressor of clear homolog (C. elegans)
• Calculated Molecular Weight: 582 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC050445
• Gene Symbol: SHOC2/Sur-8
• Gene ID (NCBI): 8036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UQ13
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SHOC2 is also named as Sur-8. The SHOC2 protein, along with MRAS and PP1C, forms a high affinity, heterotrimeric holoenzyme that activates RAF kinases by dephosphorylating a specific phosphoserine (PMID: 37074066). SHOC2, a key protein mediating the Ras-Raf-ERK pathway, could act as a scaffolding protein to facilitate the activation of the pathway by mediating the interaction of key components of the pathway (PMID: 37170083). The scaffold protein Shoc2 is a critical modulator of ERK1/2 signals, and mutations in the shoc2 gene lead to the human developmental disease known as Noonan-like syndrome with loose anagen hair (NSLH) (PMID: 36265687).