Home
Products
Primary Antibodies
SIAH1 Polyclonal antibody, PBS Only (13886-1-PBS)

Filter: AllWBIHC

WB analysis of HeLa using 13886-1-AP (same clone as 13886-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 13886-1-AP (same clone as 13886-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 13886-1-AP (same clone as 13886-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of RAW264.7 using 13886-1-AP (same clone as 13886-1-PBS)
RAW264.7 cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of mouse small intestine using 13886-1-AP (same clone as 13886-1-PBS)
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 13886-1-AP (same clone as 13886-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 13886-1-AP (same clone as 13886-1-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 13886-1-AP (same clone as 13886-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 13886-1-AP (SIAH1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 13886-1-AP (same clone as 13886-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13886-1-AP (SIAH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 13886-1-AP (same clone as 13886-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13886-1-AP (SIAH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13886-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

SIAH1 Polyclonal antibody, PBS Only

Name: SIAH1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 13886-1-PBS

SIAH1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13886-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

13886-1-PBS targets SIAH1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4336 Product name: Recombinant human SIAH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC035562 Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC Predict reactive species
Full Name	seven in absentia homolog 1 (Drosophila)
Calculated Molecular Weight	282 aa, 31 kDa
Observed Molecular Weight	60 kDa
GenBank Accession Number	BC035562
Gene Symbol	SIAH1
Gene ID (NCBI)	6477
RRID	AB_10643374
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8IUQ4
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SIAH1, also named as HUMSIAH, Siah-1a and Siah-1S(21kd), belongs to the SINA (Seven in absentia) family. SIAH1 is known to cause indirect degradation of beta-catenin through formation of a complex with Siah-interacting protein (SIP), Skp1 and Ebi. SIAH1 can form heterodimer or homodimer such as Siah-1*Siah-1(70 or 62kd), Siah-1*Siah-1S(42kd) and Siah-1S*Siah-1S(51-56kd). Importantly, results from in vitro soft agar assay demonstrated that Siah-1S displays a promotion effect on cells tumorigenicity. (PMID:17420721)