SIAH2 Polyclonal antibody

• 

  WB analysis of mouse brain using 12651-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12651-1-AP (SIAH2 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis using 12651-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12651-1-AP (SIAH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 12651-1-AP

  IP result of anti-SIAH2 (IP:12651-1-AP, 4ug; Detection:12651-1-AP 1:500) with MCF-7 cells lysate 760 ug.

• 

  IHC staining of mouse brain using 12651-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12651-1-AP (SIAH2 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12651-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12651-1-AP (SIAH2 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-12 using 12651-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PC-12 cells using SIAH2 antibody (12651-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

SIAH2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12651-1-AP

Publications(15)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

5N16, E3 ubiquitin-protein ligase SIAH2, EC:2.3.2.27, hSiah2, RING-type E3 ubiquitin transferase SIAH2

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse brain tissue, MDA-MB-231 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 7 publications below
• WB: See 14 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 3 publications below

Product Information

12651-1-AP targets SIAH2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3342

  Product name: Recombinant human SIAH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC013082

  Sequence: MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP

• Full Name: seven in absentia homolog 2 (Drosophila)
• Calculated Molecular Weight: 324 aa, 35 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC013082
• Gene Symbol: SIAH2
• Gene ID (NCBI): 6478
• RRID: AB_2877868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43255
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian Seven-in-absentia homolog 2 (SIAH2), is a RING finger type ubiquitin ligase with a catalytic RING domain on its N-terminus, followed by two zinc fingers and a C-terminal substrate binding domain. Siah is a mammalian homolog of Sina, a Drosophila protein functioning in eye development. Mammals express two isoforms, Siah1 and 2, and mice exhibit two Siah1 isotypes, 1a and 1b. SIAH2 indirectly regulates the level of HIF-1α by promoting degradation of PHDs by UPS. SIAH2, in turn, is positively regulated by hypoxia-dependent transcriptional and posttranscriptional mechanisms.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Heat stress activates YAP/TAZ to induce the heat shock transcriptome.; Authors - Min Luo ; KD Validated
human	WB	Nucleic Acids Res; P-TEFb is degraded by Siah1/2 in quiescent cells.; Authors - Fang Huang ; KD Validated
human	WB	J Exp Clin Cancer Res; PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer; Authors - Liang Xu
human	WB,IP	Int J Biol Sci; Cold atmospheric plasma potentiates ferroptosis via EGFR(Y1068)-mediated dual axes on GPX4 among triple negative breast cancer cells; Authors - Xiaofeng Dai
		Cell Death Dis; PIWIL2 suppresses Siah2-mediated degradation of HDAC3 and facilitates CK2α-mediated HDAC3 phosphorylation.; Authors - Yingying Zhang
mouse	WB,IF	Int Immunopharmacol; Methylene blue targets PHD3 expression in murine microglia to mitigate lipopolysaccharide-induced neuroinflammation and neurocognitive impairments; Authors - Guoyao Ou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Patrick (Verified Customer) (11-13-2019)

Couldn't detect endogenous or overexpressed SIAH2

• Applications: Western Blot,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: 293T