Tested Applications
| Positive WB detected in | MCF-7 cells, mouse brain tissue, MDA-MB-231 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12651-1-AP targets SIAH2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3342 Product name: Recombinant human SIAH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC013082 Sequence: MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP Predict reactive species |
| Full Name | seven in absentia homolog 2 (Drosophila) |
| Calculated Molecular Weight | 324 aa, 35 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC013082 |
| Gene Symbol | SIAH2 |
| Gene ID (NCBI) | 6478 |
| RRID | AB_2877868 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43255 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian Seven-in-absentia homolog 2 (SIAH2), is a RING finger type ubiquitin ligase with a catalytic RING domain on its N-terminus, followed by two zinc fingers and a C-terminal substrate binding domain. Siah is a mammalian homolog of Sina, a Drosophila protein functioning in eye development. Mammals express two isoforms, Siah1 and 2, and mice exhibit two Siah1 isotypes, 1a and 1b. SIAH2 indirectly regulates the level of HIF-1α by promoting degradation of PHDs by UPS. SIAH2, in turn, is positively regulated by hypoxia-dependent transcriptional and posttranscriptional mechanisms.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| IHC protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| IP protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| WB protocol for SIAH2 antibody 12651-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SIAH2 Polyclonal antibody (Cat# 12651-1-AP) has 19 citations spanning journals including Nature Cell Biology, Nature Communications, Cell Reports, Nucleic Acids Research, Cell Death & Disease, eLife, Journal of Biological Chemistry, and others. Research fields cover tumor microenvironment remodeling, ferroptosis, xenophagy, pulmonary arterial remodeling, renal injury, neuroinflammation, colorectal and breast cancer, lipid metabolism, antiviral immunity, heat stress responses, and inflammatory gene regulation. Applications include WB, IHC, IF, and IP.
| Species | Application | Title |
|---|---|---|
Cell Mol Immunol Dynamic regulation of TBK1 lactylation shapes antiviral immune responses. | ||
Nat Cell Biol Heat stress activates YAP/TAZ to induce the heat shock transcriptome.
| ||
Nat Commun The SIAH2-NRF1 axis spatially regulates tumor microenvironment remodeling for tumor progression.
| ||
J Exp Clin Cancer Res PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer | ||
Cell Death Dis PIWIL2 suppresses Siah2-mediated degradation of HDAC3 and facilitates CK2α-mediated HDAC3 phosphorylation. |
Reviews
What customers say
The single available review reports a negative experience. The user attempted to detect both endogenous and overexpressed SIAH2 using this antibody in Western Blot on 293T cells at a 1:500 dilution, but was unable to detect the target in either case. The reviewer rated the product 1 out of 5 stars.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Patrick (Verified Customer) (11-13-2019) | Couldn't detect endogenous or overexpressed SIAH2
|
