Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SIGMAR1 Polyclonal antibody

SIGMAR1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15168-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Sigma 1-type opioid receptor, Sigma 1 type opioid receptor, OPRS1, hSigmaR1, Aging-associated gene 8 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, mouse kidney tissue, mouse colon tissue, rat colon tissue
Positive IHC detected inhuman liver cancer tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15168-1-AP targets SIGMAR1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat, monkey, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7351

Product name: Recombinant human SIGMAR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 101-223 aa of BC004899

Sequence: SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Predict reactive species
Full Name sigma non-opioid intracellular receptor 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC004899
Gene Symbol SIGMAR1
Gene ID (NCBI) 10280
RRIDAB_2301712
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99720
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIGMAR1, also named as OPRS1, SRBP, SIG-1R and AAG8, belongs to the ERG2 family. It is an endoplasmic reticulum chaperone that binds a wide variety of ligands, including neurosteroids, psychostimulants, and dextrobenzomorphans. SIGMAR1 is ubiquitously expressed, and is enriched in motor neurons of the brain and spinal cord. It plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. SIGMAR1 plays a role in several other cell functions including proliferation, survival and death. SDS-PAGE and Western blot analysis showed that SIGMAR1 has an apparent molecular mass of 28 kDa. SIGMAR1 has 5 isoforms with MW 21-27kDa and 12kDa.

Protocols

Product Specific Protocols
IHC protocol for SIGMAR1 antibody 15168-1-APDownload protocol
WB protocol for SIGMAR1 antibody 15168-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Nat Commun

ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimer's disease models.

Authors - Yuanyuan Zhao
humanWB

Ann Neurol

Hereditary Spastic Paraplegia-Linked REEP1 Modulates ER-Mitochondria Contacts.

Authors - Youngshin Lim

Proc Natl Acad Sci U S A

DJ-1 regulates the integrity and function of ER-mitochondria association through interaction with IP3R3-Grp75-VDAC1.

Authors - Yi Liu
mouseWB

Schizophr Bull

Allosteric Modulation of the Sigma-1 Receptor Elicits Antipsychotic-like Effects.

Authors - Jiali Chen
mouseWB

Cell Mol Life Sci

PACS2-TRPV1 axis is required for ER-mitochondrial tethering during ER stress and lung fibrosis.

Authors - Jessica Knoell
zebrafishWB

Int J Mol Sci

Sigma-1 Receptor Is Critical for Mitochondrial Activity and Unfolded Protein Response in Larval Zebrafish.

Authors - Lucie Crouzier
  • KD Validated

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Lenie (Verified Customer) (07-15-2025)

Used on frozen section of zebrafish tissue

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/200 (IF)
  • Cell Tissue Type: Zebrafish
SIGMAR1 Antibody Immunofluorescence validation (1/200 (IF) dilution) in Zebrafish (Cat no:15168-1-AP)

Anastasia (Verified Customer) (08-07-2024)

SigmaR1 IF in zebrafish embryos with EGFP labeled ER

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400 (for IF)
  • Cell Tissue Type: Zebrafish embryos
SIGMAR1 Antibody Immunofluorescence validation (1:400 (for IF) dilution) in Zebrafish embryos (Cat no:15168-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...