SIK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SIK2 Polyclonal antibody, PBS Only (27608-1-PBS)

• 

  WB analysis using 27608-1-AP (same clone as 27608-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27608-1-AP (SIK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27608-1-AP (same clone as 27608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27608-1-AP (SIK2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27608-1-PBS in a different storage buffer formulation.

SIK2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27608-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

SIK 2, salt inducible kinase 2, Qin induced kinase, QIK, LOH11CR1I

---

Product Information

27608-1-PBS targets SIK2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26468

  Product name: Recombinant human SIK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 617-926 aa of BC113459

  Sequence: VQLLYEQIGPEADPNLAPAAPQLQDLASSCPQEEVSQQQESVSTLPASVHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSLTQPLSPVLEPSSEQMQYSPFLSQYQEMQLQPLPSTSGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPAPLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCEMLDAVDPQHNGYVLVN

• Full Name: salt-inducible kinase 2
• Calculated Molecular Weight: 926 aa, 104 kDa
• Observed Molecular Weight: 103-110 kDa
• GenBank Accession Number: BC113459
• Gene Symbol: SIK2
• Gene ID (NCBI): 23235
• RRID: AB_3669614
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0K1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.