PMEL/Melanoma gp100 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PMEL/Melanoma gp100 Polyclonal antibody (27329-1-AP)

PMEL/Melanoma gp100 Polyclonal Antibody for IHC, ELISA

Cat No. 27329-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, ELISA

Synonyms

PMEL, SILV, gp 100, gp100, M-alpha

• 

  IHC staining of human malignant melanoma using 27329-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 27329-1-AP (SILV Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 27329-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 27329-1-AP (SILV Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PMEL/Melanoma gp100 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human malignant melanoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27329-1-AP targets PMEL/Melanoma gp100 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25796

  Product name: Recombinant human PMEL/Melanoma gp100 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 470-595 aa of BC001414

  Sequence: QVPLDCVLYRYGSFSVTLDIVQGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQ

• Full Name: silver homolog (mouse)
• Calculated Molecular Weight: 70 kDa
• GenBank Accession Number: BC001414
• Gene Symbol: SILV
• Gene ID (NCBI): 6490
• RRID: AB_2880846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40967
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PMEL/Melanoma gp100 Polyclonal antibody (Cat# 27329-1-AP) has 1 total citation. It appears in the International Journal of Molecular Sciences (IF 5.6), in a study investigating how Pmel17 deficiency affects melanogenesis and promotes tumor vascularization. The research falls within the fields of melanocyte biology, pigmentation, and tumor angiogenesis, with the antibody applied in IHC on mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Int J Mol Sci; Pmel17 Deficiency Affects Melanogenesis and Promotes Tumor Vascularization.; Authors - Justyna Sopel ; KO Validated