PMEL/Melanoma gp100 Polyclonal antibody

• 

  IHC staining of human malignant melanoma using 27329-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 27329-1-AP (SILV Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human malignant melanoma using 27329-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 27329-1-AP (SILV Antibody) at dilution of 1:200 (under 40x lens).

PMEL/Melanoma gp100 Polyclonal Antibody for IHC, ELISA

Cat No. 27329-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, ELISA

Synonyms

PMEL, SILV, gp 100, gp100, M-alpha

---

Tested Applications

• Positive IHC detected in: human malignant melanoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• IHC: See 1 publications below

Product Information

27329-1-AP targets PMEL/Melanoma gp100 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25796

  Product name: Recombinant human SILV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 470-595 aa of BC001414

  Sequence: QVPLDCVLYRYGSFSVTLDIVQGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQ

• Full Name: silver homolog (mouse)
• Calculated Molecular Weight: 70 kDa
• GenBank Accession Number: BC001414
• Gene Symbol: SILV
• Gene ID (NCBI): 6490
• RRID: AB_2880846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40967
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Int J Mol Sci; Pmel17 Deficiency Affects Melanogenesis and Promotes Tumor Vascularization.; Authors - Justyna Sopel ; KO Validated