SIPA1L3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIPA1L3 Polyclonal antibody (30544-1-AP)

SIPA1L3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 30544-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

SPA-1-like protein 3, SPA 1 like protein 3, SIPA1-like protein 3, SIPA1 like protein 3, Signal-induced proliferation-associated 1-like protein 3

• 

  WB analysis using 30544-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30544-1-AP (SIPA1L3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30544-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30544-1-AP (SIPA1L3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 30544-1-AP

  IP result of anti-SIPA1L3 (IP:30544-1-AP, 4ug; Detection:30544-1-AP 1:3000) with HeLa cells lysate 1320 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 30544-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30544-1-AP (SIPA1L3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 30544-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SIPA1L3 antibody (30544-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 30544-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using SIPA1L3 antibody (30544-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SIPA1L3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HeLa cells, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30544-1-AP targets SIPA1L3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30750

  Product name: Recombinant human SIPA1L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC150620

  Sequence: MTTYRAIPSDGVDLAASCGARVGDVLPGPHTGDYAPLGFWAQNGSMSQPLGESPATATATATATTRPSPTTPAMPKMGVRARVADWPPKREALREHSNPSPSQDTDGTKATKMAHSMRSIQNGQPPTSTPASSGSKAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECDAEDAGEPRGARHTGALPLFREYGSTSSIDVQGMPEQSFFDILNEFRSEQPDARGCQALTELLRADPGPHLMGGGGGAKGDSHNGQPAKDSLLPLQPTKEKEKARKKPARGLGGGDTVDSS

• Full Name: signal-induced proliferation-associated 1 like 3
• Observed Molecular Weight: 195 kDa
• GenBank Accession Number: BC150620
• Gene Symbol: SIPA1L3
• Gene ID (NCBI): 23094
• RRID: AB_3086357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60292
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STEAP3 (Signal-induced proliferation-associated 1-like protein 3) is also named as KIAA0545 and SPAL3. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).

Publications

What published studies show

The SIPA1L3 Polyclonal antibody (Cat# 30544-1-AP) has 2 total citations. Both appear in bioRxiv and eLife, from the same research group (Tetenborg et al.). The studies focus on uncovering the electrical synapse proteome in retinal neurons using in vivo proximity labeling, placing the citations in the fields of neuroscience and retinal cell biology. Applications cited include WB, IP, IF, and IHC, with reactivity in human and mouse.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC,IF	Elife; Uncovering the electrical synapse proteome in retinal neurons via in vivo proximity labeling.; Authors - Stephan Tetenborg
human,mouse	WB,IP,IF	bioRxiv; Uncovering the electrical synapse proteome in retinal neurons via in vivo proximity labeling; Authors - Stephan Tetenborg