SIRP beta 1/CD172b Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIRP beta 1/CD172b Polyclonal antibody (11811-1-AP)

SIRP beta 1/CD172b Polyclonal Antibody for WB, ELISA

Cat No. 11811-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

SIRPB1, SIRP Beta 1, SIRP-beta-1, Signal-regulatory protein beta-1, CD172b

• 

  WB analysis using 11811-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 11811-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 11811-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11811-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 11811-1-AP (SIRP BETA 1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SIRP beta 1/CD172b in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-937 cells, A375 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11811-1-AP targets SIRP beta 1/CD172b in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2478

  Product name: Recombinant human SIRPB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC025286

  Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

• Full Name: signal-regulatory protein beta 1
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC025286
• Gene Symbol: SIRPB1
• Gene ID (NCBI): 10326
• RRID: AB_2188197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00241
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK.

Publications

What published studies show

The SIRP beta 1/CD172b polyclonal antibody (Cat# 11811-1-AP) has 4 total citations. These appear in iScience, Frontiers in Oncology, PLoS One, and Neuropathology. The associated research fields include cutaneous malignant melanoma tumorigenicity, primary malignant melanoma of the cervix, primary myelofibrosis genetics, and neurodegenerative disease (Nasu-Hakola disease). All citations used the antibody for IHC in human samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	iScience; SIRPB1 is transcriptionally regulated by USF2 and promotes cutaneous malignant melanoma tumorigenicity through SOCS1/STAT3 signaling.; Authors - Danmei Ning
human	IHC	Front Oncol; The genetic landscape of primary malignant melanoma of the cervix using integrated bioinformatics analysis and whole-exome sequencing.; Authors - Jialiu Zhou
human	IHC	PLoS One; SNPs array karyotyping reveals a novel recurrent 20p13 amplification in primary myelofibrosis.; Authors - Visani Giuseppe G
human	IHC	Neuropathology; Immunohistochemical characterization of microglia in Nasu-Hakola disease brains.; Authors - Satoh Jun-Ichi J