SIRT3 Recombinant monoclonal antibody, PBS Only

SIRT3 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 82210-1-PBS
Clone No.2P6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

EC:2.3.1.286, hSIRT3, NAD-dependent protein deacetylase sirtuin-3, mitochondrial, Regulatory protein SIR2 homolog 3, SIR2 like protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82210-1-PBS targets SIRT3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26280

Product name: Recombinant human SIRT3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 202-399 aa of BC001042

Sequence: GNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Predict reactive species
Full Name sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
Calculated Molecular Weight 44 kDa
Observed Molecular Weight28-30 kDa
GenBank Accession NumberBC001042
Gene Symbol SIRT3
Gene ID (NCBI) 23410
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NTG7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Sirtuins are NAD+-dependent histone/protein deacetylases (HDAC) and SIRT3 is the only sirtuin whose increased expression has been shown to correlate with an extended life span in humans. It is localized in the mitochondrial matrix, where it regulates the acetylation levels of metabolic enzymes, including acetyl coenzyme A synthetase 2. SIRT3 is stress-responsive and its increased expression protects myocytes from genotoxic and oxidative stress-mediated cell death. full-length hSIRT3 (44 kDa) is an inert protein and that it is activated inside the mitochondria following deletion of 142 amino acids of the N-terminal segment. This processed form of SIRT3 is approximately 28 kDa and possesses deacetylase activity. The full SIRT3 is a 44 kDa protein and is processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product.

Loading...
||
New chat

Able

正在加载,请稍候...