SIRT4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIRT4 Polyclonal antibody (28148-1-AP)

SIRT4 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 28148-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, ELISA

Synonyms

EC:2.3.1.-, EC:2.3.1.286, EC:2.4.2.-, NAD-dependent ADP-ribosyltransferase sirtuin-4, NAD-dependent protein biotinylase sirtuin-4

• 

  WB analysis using 28148-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28148-1-AP (SIRT4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 28148-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SIRT4 antibody (28148-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse liver tissue
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28148-1-AP targets SIRT4 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28003

  Product name: Recombinant human SIRT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 149-306 aa of BC109319

  Sequence: HTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGE

• Full Name: sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
• Calculated Molecular Weight: 314 aa, 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC109319
• Gene Symbol: SIRT4
• Gene ID (NCBI): 23409
• RRID: AB_3742279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6E7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIRT4, also named as NAD-dependent protein lipoamidase sirtuin-4, mitochondria, is a 314 amino acid protein, which belongs to the sirtuin family. Class II subfamily. SIRT4 is detected in vascular smooth muscle and striated muscle. SIRT4 is detected in insulin-producing beta-cells in pancreas islets of Langerhans. SIRT4 Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. It catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications and inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner. SIRT4 expression is down-regulated in a number of cancers, while overexpression reduces cell proliferation, transformation, and tumor development.