SIRT5 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67257-1-Ig (same clone as 67257-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67257-1-Ig (SIRT5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67257-1-Ig (same clone as 67257-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67257-1-Ig (SIRT5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 67257-1-Ig (same clone as 67257-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 67257-1-Ig (SIRT5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67257-1-Ig (same clone as 67257-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67257-1-Ig (SIRT5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67257-1-Ig (same clone as 67257-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67257-1-Ig (SIRT5 antibody) at dilution of 1:4800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67257-1-Ig (same clone as 67257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67257-1-Ig (SIRT5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67257-1-Ig (same clone as 67257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67257-1-Ig (SIRT5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67257-1-Ig (same clone as 67257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67257-1-Ig (SIRT5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67257-1-Ig (same clone as 67257-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67257-1-Ig (SIRT5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67257-1-PBS in a different storage buffer formulation.

SIRT5 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67257-1-PBS

Clone No.1F2B2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

1F2B2, EC:2.3.1.-, NAD-dependent protein deacylase sirtuin-5, mitochondrial, Regulatory protein SIR2 homolog 5, SIR2L5

---

Product Information

67257-1-PBS targets SIRT5 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7743

  Product name: Recombinant human SIRT5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-310 aa of BC000126

  Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

• Full Name: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000126
• Gene Symbol: SIRT5
• Gene ID (NCBI): 23408
• RRID: AB_2882530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NXA8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in . It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels.