SIRT6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIRT6 Polyclonal antibody (28677-1-AP)

• 

  WB analysis using 28677-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28677-1-AP (SIRT6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 28677-1-AP

  WB result of SIRT6 antibody (28677-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SIRT6 transfected HeLa cells.

• 

  IHC staining of human placenta using 28677-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 28677-1-AP (SIRT6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28677-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28677-1-AP (SIRT6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 28677-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using SIRT6 antibody (28677-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

SIRT6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28677-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

EC:2.3.1.-, EC:2.3.1.286, EC:2.4.2.-, hSIRT6, NAD-dependent protein deacetylase sirtuin-6

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells
• Positive IHC detected in: human placenta tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

28677-1-AP targets SIRT6 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29163

  Product name: Recombinant human SIRT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-328 aa of BC028220

  Sequence: ATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

• Full Name: sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae)
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC028220
• Gene Symbol: SIRT6
• Gene ID (NCBI): 51548
• RRID: AB_3669666
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6T7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SIRT6 gene is located at chromosome 19p13.3 and contains 8 exons. The encoded protein has a total length of 355 amino acids. SIRT6 protein is a member of the Sirtuins, which is a class of NAD+-dependent protein deacetylases involved in stress resistance and metabolic homeostasis. SIRT6 also plays roles in various tumors as both an oncogene and tumor suppressor gene. A previous study in osteosarcoma reported that SIRT6 regulates the migration and invasion of tumors through the ERK1/2/MMP9 pathway. (PMID: 30675128)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Mol Cell Biochem; Squalene attenuates doxorubicin resistance in hepatocellular carcinoma by targeting SIRT6 to inhibit ERK1 deacetylation.; Authors - Geqiong Xiao
mouse	IHC,IF	Adv Healthc Mater; Remodeling Cellular Uptake via Inducing Clustering of Urokinase Receptors in Hydrogel Microspheres for Alleviating Cartilage Senescence.; Authors - Zhiqi Lin
	IF,CoIP	Redox Biol; Translocation of SIRT6 promotes glycolysis reprogramming to exacerbate diabetic angiopathy.; Authors - Kemiao Pang