Filter:
Product Information
12992-1-AP targets SIVA1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3654 Product name: Recombinant human SIVA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC034562 Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET Predict reactive species |
| Full Name | SIVA1, apoptosis-inducing factor |
| Calculated Molecular Weight | 175 aa, 19 kDa |
| GenBank Accession Number | BC034562 |
| Gene Symbol | SIVA1 |
| Gene ID (NCBI) | 10572 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15304 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SIVA1, also named as SIVA, CD27BP, is an apoptosis regulatory protein. It induces the CD27-mediated apoptosis. SIVA is required for its binding to BCL-XL and sensitizing cells to UV radiation.
