SIVA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIVA1 Polyclonal antibody (27119-1-AP)

• 

  WB analysis using 27119-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27119-1-AP (SIVA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SIVA1 Polyclonal Antibody for WB, ELISA

Cat No. 27119-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CD27 binding protein, CD27-binding protein, CD27BP, SIVA, Siva 1

---

Tested Applications

• Positive WB detected in: MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27119-1-AP targets SIVA1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25748

  Product name: Recombinant human SIVA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC034562

  Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERA

• Full Name: SIVA1, apoptosis-inducing factor
• Calculated Molecular Weight: 175 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC034562
• Gene Symbol: SIVA1
• Gene ID (NCBI): 10572
• RRID: AB_3742216
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15304
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.