SIX5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIX5 Polyclonal antibody (22938-1-AP)

• Featured Product
• KD/KO Validated

SIX5 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 22938-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ChIP, ELISA

Synonyms

Homeobox protein SIX5, DMAHP, DM locus-associated homeodomain protein

• 

  WB analysis using 22938-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22938-1-AP (SIX5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22938-1-AP

  WB result of SIX5 antibody (22938-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SIX5 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Y79 using 22938-1-AP

  IP result of anti-SIX5 (IP:22938-1-AP, 4ug; Detection:22938-1-AP 1:300) with Y79 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 22938-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22938-1-AP (SIX5 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SIX5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, Y79 cells
• Positive IP detected in: Y79 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22938-1-AP targets SIX5 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18993

  Product name: Recombinant human SIX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 586-739 aa of BC156983

  Sequence: PLKPETAISVPEGGLPVAPSPALPEAHALGTLSAQQPPPAAATTSSTSLPFSPDSPGLLPNFPAPPPEGLMLSPAAVPVWSAGLELSAGTEGLLEAEKGLGTQAPHTVLRLPDPDPEGLLLGATAGGEVDEGLEAEAKVLTQLQSVPVEEPLEL

• Full Name: SIX homeobox 5
• Calculated Molecular Weight: 739 aa, 75 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC156983
• Gene Symbol: SIX5
• Gene ID (NCBI): 147912
• RRID: AB_2879186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N196
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SIX5 polyclonal antibody (Cat# 22938-1-AP) has 3 citations. These appear in Immunity (human tonsil cell atlas), iScience (myogenesis and transcriptional regulation in mouse), and Brain Research (glioblastoma progression and angiogenesis). The research fields span immunology, developmental biology, and oncology. Applications cited include Western blot and ChIP.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Immunity; An atlas of cells in the human tonsil; Authors - Ramon Massoni-Badosa
mouse	WB	iScience; RBFOX2 regulated EYA3 isoforms partner with SIX4 or ZBTB1 to control transcription during myogenesis; Authors - Hannah J Wiedner
human	ChIP	Brain Res; Role of SIX5-mediated EXO1 overexpression in driving glioblastoma progression: Insights into tumor cell migration and angiogenesis.; Authors - Dan Zhou ; KD Validated