Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, MCF-7 cells, mouse brain tissue, mouse testis tissue |
| Positive IHC detected in | human gliomas tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10990-2-AP targets SKP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1457 Product name: Recombinant human SKP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC009839 Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK Predict reactive species |
| Full Name | S-phase kinase-associated protein 1 |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC009839 |
| Gene Symbol | SKP1 |
| Gene ID (NCBI) | 6500 |
| RRID | AB_2187492 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63208 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SKP1(S-phase kinase-associated protein 1) is also named as EMC19, OCP2, SKP1A, TCEB1L,belongs to the SKP1 family.It is an essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SKP1 antibody 10990-2-AP | Download protocol |
| WB protocol for SKP1 antibody 10990-2-AP | Download protocol |
| IF protocol for SKP1 antibody 10990-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SKP1 antibody (Cat# 10990-2-AP) has 17 total citations published in journals including Nature Chemical Biology, Science, eLife, Cancer Communications, Journal of Experimental & Clinical Cancer Research, Advanced Science, Pharmacological Research, Journal of Cell Biology, and others. Research fields span hepatocellular carcinoma, non-small cell lung cancer, skeletal muscle myogenesis, meiosis, macrophage pyroptosis, septic cardiomyopathy, dermatomyositis, thyroid-associated ophthalmopathy, ubiquitin ligase biology, and ciliary structure.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) HMMR alleviates endoplasmic reticulum stress by promoting autophagolysosomal activity during endoplasmic reticulum stress-driven hepatocellular carcinoma progression | ||
J Exp Clin Cancer Res Long non-coding RNA CCDC183-AS1 acts AS a miR-589-5p sponge to promote the progression of hepatocellular carcinoma through regulating SKP1 expression. | ||
Adv Sci (Weinh) A Circular RNA Generated from Nebulin (NEB) Gene Splicing Promotes Skeletal Muscle Myogenesis in Cattle as Detected by a Multi-Omics Approach | ||
Pharmacol Res Brusatol has therapeutic efficacy in non-small cell lung cancer by targeting Skp1 to inhibit cancer growth and metastasis. | ||
Cell Biosci Neddylation is indispensable for early meiotic progression in spermatocytes via destabilizing HORMAD1 by SCF ubiquitin E3 ligase during synapsis. |
Reviews
What customers say
One reviewer (Wei Feng) gave this product a 5-star rating after using it for Western Blot on mouse heart tissue (lot 00058732). They noted that the band was weak but appeared at the correct molecular weight, suggesting the antibody is specific even if signal intensity may be suboptimal under their conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
WEI (Verified Customer) (05-11-2022) | Weak band but at correct size.
|
