SLA Polyclonal antibody

• 

SLA Polyclonal Antibody for ELISA

Cat No. 10710-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

hSLAP, SLA, SLA1, SLAP, SLAP 1, SLAP1, Src like adapter, Src like adapter protein 1, Src like adaptor

---

Product Information

10710-1-AP targets SLA in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1073

  Product name: Recombinant human SLA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC007042

  Sequence: MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED

• Full Name: Src-like-adaptor
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: BC007042
• Gene Symbol: SLA
• Gene ID (NCBI): 6503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13239
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.