SLAIN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLAIN2 Polyclonal antibody (13908-1-AP)

SLAIN2 Polyclonal Antibody for WB, ELISA

Cat No. 13908-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

KIAA1458, SLAIN motif family, member 2, SLAIN motif-containing protein 2

• 

  WB analysis of mouse brain using 13908-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13908-1-AP (SLAIN2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 13908-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 13908-1-AP (SLAIN2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLAIN2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, Transfected HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13908-1-AP targets SLAIN2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4888

  Product name: Recombinant human SLAIN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 231-581 aa of BC040993

  Sequence: PGNSGNLKSSDRNPPLSPQSSIDSELSASELDEDSIGSNYKLNDVTDVQILARMQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHHAVYPAVNRFSPSPRNSPRPSPKQSPRNSPRSRSPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMRSGLPRPSAPSAGGIPVPRSKLAQPVRRSLPAPKTYGSMKDDSWKDGCY

• Full Name: SLAIN motif family, member 2
• Calculated Molecular Weight: 581 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC040993
• Gene Symbol: SLAIN2
• Gene ID (NCBI): 57606
• RRID: AB_2877987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P270
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLAIN2 (SLAIN Motif Family Member 2), also known as KIAA1458, is a microtubule plus-end tracking protein (+TIP) that forms a complex with end-binding proteins (EBs), cytoplasmic linker proteins (CLIPs), and ch-TOG. SLAIN2 binds to the plus end of microtubules and regulates microtubule growth and organization. SLAIN2 consists of 581 amino acids and has a calculated molecular weight of approximately 63 kDa.

Publications

What published studies show

The SLAIN2 Polyclonal antibody (Cat# 13908-1-AP) has 1 citation. It was cited in Turkish Journal of Biology (IF 1.7, 2020) in a study on proximity mapping of the microtubule plus-end tracking protein SLAIN2 using the BioID approach. The research field is cell biology, specifically microtubule dynamics and protein–protein interaction mapping. The antibody was applied in WB and IF for human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Turk J Biol; Proximity mapping of the microtubule plus-end tracking protein SLAIN2 using the BioID approach.; Authors - Elif Nur Firat-Karalar