SLC10A4 Polyclonal antibody

• 

  WB analysis using 31329-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31329-1-AP (SLC10A4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SLC10A4 Polyclonal Antibody for WB, ELISA

Cat No. 31329-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

P4, SLC10A4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31329-1-AP targets SLC10A4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34358

  Product name: Recombinant human SLC10A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 313-437 aa of BC019066

  Sequence: ASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL

• Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 4
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC019066
• Gene Symbol: SLC10A4
• Gene ID (NCBI): 201780
• RRID: AB_3669945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96EP9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC10A4 belongs to the solute carrier superfamily and is a protease-activated transporter involved in uptake of bile acid (PMID: 23589386). SLC10A4 is expressed with a high expression in brain and is a vesicular monoaminergic and cholinergic-associated transporter that is important for dopamine homeostasis and neuromodulation (PMID: 25176177).