MCT4 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 22787-1-AP (same clone as 22787-1-PBS)

  WB result of MCT4 antibody (22787-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MCT4 transfected HeLa cells. This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22787-1-AP (same clone as 22787-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22787-1-AP (MCT4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22787-1-AP (same clone as 22787-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22787-1-AP (MCT4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat skeletal muscle using 22787-1-AP (same clone as 22787-1-PBS)

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22787-1-AP (MCT4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 22787-1-AP (MCT4 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 22787-1-AP (MCT4 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 22787-1-AP (MCT4 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 22787-1-AP (MCT4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22787-1-AP (MCT4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22787-1-AP (MCT4 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22787-1-AP (MCT4 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 22787-1-AP (MCT4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 22787-1-AP (MCT4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 22787-1-AP (MCT4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 22787-1-AP (MCT4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22787-1-AP (MCT4 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22787-1-AP (same clone as 22787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22787-1-AP (MCT4 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 22787-1-AP (same clone as 22787-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MCT4 antibody (22787-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 22787-1-AP (same clone as 22787-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MCT4 antibody (22787-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red) and CoraLite594-conjugated Goat Anti-Mouse IgG(H+L)(SA00013-3). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 22787-1-AP (same clone as 22787-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MCT4 antibody (22787-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red). This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 22787-1-AP (same clone as 22787-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.8 ug Anti-Human MCT4 (22787-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 22787-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MCT4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 22787-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

MCT-4, SLC16A3, MCT 4, MCT3

---

Product Information

22787-1-PBS targets MCT4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18788

  Product name: Recombinant human SLC16A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 402-465 aa of BC112269

  Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV

• Full Name: solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
• Calculated Molecular Weight: 465 aa, 49 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC112269
• Gene Symbol: MCT4
• Gene ID (NCBI): 9123
• RRID: AB_11182479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15427
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.