• Featured Product
  • KD/KO Validated

MCT4 Polyclonal antibody

MCT4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 22787-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

MCT-4, SLC16A3, MCT 4, MCT3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, unboiled PC-3 cells, rat skeletal muscle tissue, HepG2 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human renal cell carcinoma tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:20000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22787-1-AP targets MCT4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18788

Product name: Recombinant human SLC16A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 402-465 aa of BC112269

Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV

Predict reactive species
Full Name solute carrier family 16, member 3 (monocarboxylic acid transporter 4)
Calculated Molecular Weight 465 aa, 49 kDa
Observed Molecular Weight 38-42 kDa
GenBank Accession NumberBC112269
Gene Symbol MCT4
Gene ID (NCBI) 9123
RRIDAB_11182479
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15427
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects.

Protocols

Product Specific Protocols
FC protocol for MCT4 antibody 22787-1-APDownload protocol
IF protocol for MCT4 antibody 22787-1-APDownload protocol
IHC protocol for MCT4 antibody 22787-1-APDownload protocol
WB protocol for MCT4 antibody 22787-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
mouseWB

Nat Cancer

Targeting the bicarbonate transporter SLC4A4 overcomes immunosuppression and immunotherapy resistance in pancreatic cancer

Authors - Federica Cappellesso
humanWB

Nat Metab

Lactylome analysis suggests lactylation-dependent mechanisms of metabolic adaptation in hepatocellular carcinoma

Authors - Zijian Yang
  • KD Validated

Adv Sci (Weinh)

SETDB1 Methylates MCT1 Promoting Tumor Progression by Enhancing the Lactate Shuttle

Authors - Xiaowei She
mouseIF

Nat Commun

Lactate sensing mechanisms in arterial chemoreceptor cells.

Authors - Hortensia Torres-Torrelo

Dev Cell

Lactate shuttling links histone lactylation to adult hippocampal neurogenesis in mice

Authors - Zhimin Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Amy (Verified Customer) (02-06-2026)

Used for western blotting of mammary gland tumour cells. Really clear band!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Aderonke (Verified Customer) (05-26-2023)

Immunoblotting was done to show the expression of MCT 4 in five head and neck cancer cell lines; only three of the five cell lines demonstrated this. An inhibitor was thereafter used at two differenct concentrations in UM-SCC-17A, and the expression decreased with increasing concentrations.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:20,000
  • Cell Tissue Type: Head and neck cancer cell line
FH

Juan (Verified Customer) (07-15-2019)

We used the antibody for WB method. The band backgound is clear.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Hela cells
Loading...
||
New chat

Able

正在加载,请稍候...