SLC17A9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83505-1-RR (same clone as 83505-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83505-1-RR (SLC17A9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83505-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 83505-1-RR (same clone as 83505-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 83505-1-RR (SLC17A9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83505-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 83505-1-RR (same clone as 83505-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 83505-1-RR (SLC17A9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83505-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 83505-1-RR (same clone as 83505-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 83505-1-RR (SLC17A9 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83505-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Caco-2 using 83505-1-RR (same clone as 83505-1-PBS)

  1x10^6 Caco-2 cells were intracellularly stained with 0.25 ug SLC17A9 Recombinant antibody (83505-1-RR, Clone:240328H7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83505-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83505-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83505-1-RR against Human SLC17A9 were performed. The affinity constant is below 1 pM.

SLC17A9 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 83505-1-PBS

Clone No.240328H7

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

Voltage-gated purine nucleotide uniporter SLC17A9, VNUT, Vesicular nucleotide transporter, FLJ23412, C20orf59

---

Product Information

83505-1-PBS targets SLC17A9 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24970

  Product name: Recombinant human SLC17A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC025312

  Sequence: MTLTSRRQDSQEARPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEK

• Full Name: solute carrier family 17, member 9
• Calculated Molecular Weight: 436 aa, 47 kDa
• Observed Molecular Weight: 50 kD
• GenBank Accession Number: BC025312
• Gene Symbol: SLC17A9
• Gene ID (NCBI): 63910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BYT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.