SLC1A5/ASCT2 Polyclonal antibody, PBS Only

• 

  WB analysis using 20350-1-AP (same clone as 20350-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20350-1-AP (SLC1A5/ASCT2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20350-1-AP (same clone as 20350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20350-1-AP (SLC1A5/ASCT2 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 20350-1-AP (same clone as 20350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20350-1-AP (ASCT2 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 20350-1-AP (same clone as 20350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20350-1-AP (SLC1A5/ASCT2 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 20350-1-AP (same clone as 20350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20350-1-AP (ASCT2 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 20350-1-AP (same clone as 20350-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using SLC1A5/ASCT2 antibody (20350-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), ZG16 antibody (67389-1-Ig, Clone: 1A7B9, red), CoraLite®594 smooth muscle actin specific antibody (CL594-80008, Clone: 5H7, Magenta). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 20350-1-AP (same clone as 20350-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using ASCT2 antibody (20350-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), ZG16 antibody (67389-1-Ig, Clone: 1A7B9, red), CoraLite®594 smooth muscle actin specific antibody (CL594-80008, Clone: 5H7, Magenta). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 20350-1-AP (same clone as 20350-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using ASCT2 antibody (20350-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), ZG16 antibody (67389-1-Ig, Clone: 1A7B9, red), CoraLite®594 smooth muscle actin specific antibody (CL594-80008, Clone: 5H7, Magenta). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse small intestine using 20350-1-AP (same clone as 20350-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse small intestine tissue tissue using 20350-1-AP (SLC1A5/ASCT2 antibody) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 20350-1-AP (same clone as 20350-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using SLC1A5/ASCT2 antibody (20350-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 20350-1-AP (same clone as 20350-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human SLC1A5/ASCT2 (20350-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 20350-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC1A5/ASCT2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

Cat No. 20350-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

Synonyms

SLC1A5, AAAT, ASCT2, ATB(0), ATBO

---

Product Information

20350-1-PBS targets SLC1A5/ASCT2 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14182

  Product name: Recombinant human RDRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 436-541 aa of BC000062

  Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM

• Full Name: solute carrier family 1 (neutral amino acid transporter), member 5
• Calculated Molecular Weight: 541 aa, 57 kDa
• Observed Molecular Weight: 55-70 kDa
• GenBank Accession Number: BC000062
• Gene Symbol: SLC1A5/ASCT2
• Gene ID (NCBI): 6510
• RRID: AB_2878679
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15758
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC1A5 (Solute Carrier Family 1, member 5), also named as ASCT2, a major glutamine transporter belonging to the SLC1 family and localized in the plasma membrane of several body districts. Consistent with the functions exerted by glutamine, SLC1A5 is involved in uptake of essential amino acids, activation of mTORC1 and glutamine-dependent tumor cell survival and growth. SLC1A5 is highly expressed in various malignancies and plays a critical role in the transformation, growth and survival of cancer cells (PMID: 30234109). High SLC1A5 expression is associated with poor prognosis in clear-cell renal cell carcinoma (PMID: 26599282).