• Featured Product
  • KD/KO Validated

SLC20A1 Polyclonal antibody

SLC20A1 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 12423-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

Gibbon ape leukemia virus receptor 1, GLVR1, GLVR-1, Leukemia virus receptor 1 homolog, Phosphate transporter 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, human kidney tissue, Jurkat cells, K-562 cells, unboiled HEK-293 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman liver tissue, human breast cancer tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12423-1-AP targets SLC20A1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3084

Product name: Recombinant human SLC20A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-570 aa of BC019944

Sequence: VCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGV

Predict reactive species
Full Name solute carrier family 20 (phosphate transporter), member 1
Calculated Molecular Weight 679 aa, 74 kDa
Observed Molecular Weight 85 kDa
GenBank Accession NumberBC019944
Gene Symbol SLC20A1
Gene ID (NCBI) 6574
RRIDAB_2286212
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUM9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC20A1 (also known as PiT1) is a high-affinity sodium-dependent phosphate (Pi) import protein. It is widely expressed and plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions. SLC20A1 is involved in cell proliferation, tumor growth and cell signaling independently of its transport function. SLC20A1 also functions as a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.

Protocols

Product Specific Protocols
FC protocol for SLC20A1 antibody 12423-1-APDownload protocol
IHC protocol for SLC20A1 antibody 12423-1-APDownload protocol
IP protocol for SLC20A1 antibody 12423-1-APDownload protocol
WB protocol for SLC20A1 antibody 12423-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Nat Cancer

GAP43-dependent mitochondria transfer from astrocytes enhances glioblastoma tumorigenicity

Authors - Dionysios C Watson
mouse,humanWB,CoIP

Theranostics

SGK3 promotes vascular calcification via Pit-1 in chronic kidney disease

Authors - Qing-Qing Dong
humanWB

Adv Healthc Mater

Correlating Material Properties to Osteoprotegerin Expression on Nanoparticulate Mineralized Collagen Glycosaminoglycan Scaffolds

Authors - Wei Chen
  • KD Validated
humanWB

FASEB J

PMID: 27565711

Authors - Tuyet Thi Nguyen
zebrafishIF

Front Cell Dev Biol

SLC20A1 Is Involved in Urinary Tract and Urorectal Development.

Authors - Johanna Magdalena Rieke
humanWB

J Biol Chem

Phosphate (Pi)-regulated heterodimerization of the high-affinity sodium-dependent Pi transporters PiT1/Slc20a1 and PiT2/Slc20a2 underlies extracellular Pi sensing independently of Pi uptake.

Authors - Nina Bon

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

anwesh (Verified Customer) (07-29-2019)

The protein was found at the right size as a smear. The protein undergoes heavy glycosylation, so that is expected. No additional background bands were observed around the size range.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEK293T
SLC20A1 Antibody Western Blot, validation (1:500 dilution) in HEK293T (Cat no:12423-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...