SLC22A10 Polyclonal antibody

• 

  WB analysis using 31069-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31069-1-AP (SLC22A10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 31069-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31069-1-AP (SLC22A10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 31069-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31069-1-AP (SLC22A10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC22A10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31069-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

hOAT5, OAT5, Organic anion transporter 5, SLC22A10

---

Tested Applications

• Positive WB detected in: HEK-293T cells, PC-12 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31069-1-AP targets SLC22A10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34521

  Product name: Recombinant human SLC22A10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-349 aa of NM_001039752

  Sequence: ESARWLIITNKLDEGLKALRKVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTVCDLFRNPSMRKR

• Full Name: solute carrier family 22, member 10
• Calculated Molecular Weight: 541 aa, 60 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001039752
• Gene Symbol: SLC22A10
• Gene ID (NCBI): 387775
• RRID: AB_3669842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q63ZE4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Organic anion transporter 5 (OAT5), also known as SLC22A10, belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of endogenous and exogenous organic ions (PMID: 20865662). Rare variants in SLC22A10 may be associated with Alzheimer's disease CSF profile of neuronal injury and inflammation (PMID: 35173266).