SLC22A15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC22A15 Polyclonal antibody, PBS Only (20626-1-PBS)

• 

  WB analysis of HEK-293 using 20626-1-AP (same clone as 20626-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 20626-1-AP (same clone as 20626-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 20626-1-AP (same clone as 20626-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 20626-1-AP (same clone as 20626-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 20626-1-AP (same clone as 20626-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 20626-1-AP (same clone as 20626-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 20626-1-AP (same clone as 20626-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20626-1-PBS in a different storage buffer formulation.

SLC22A15 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20626-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Flipt 1, FLIPT1, Fly-like putative transporter 1, PRO34686, UNQ9429/PRO34686

---

Product Information

20626-1-PBS targets SLC22A15 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14547

  Product name: Recombinant human SLC22A15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 431-535 aa of BC026358

  Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK

• Full Name: solute carrier family 22, member 15
• Calculated Molecular Weight: 535aa,59 kDa; 547aa,61 kDa
• Observed Molecular Weight: 61-66 kDa
• GenBank Accession Number: BC026358
• Gene Symbol: SLC22A15
• Gene ID (NCBI): 55356
• RRID: AB_10693537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZD6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.