SLC22A4 Recombinant monoclonal antibody, PBS Only (Detector)

SLC22A4 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83192-3-PBS
Clone No.240064F1

Host / Isotype

Rabbit / IgG

Reactivity

mouse, human

Applications

Cytometric bead array, Indirect ELISA

UT2H, OCTN1, ETTh, ETT, 240064F1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83192-3-PBS targets SLC22A4 as part of a matched antibody pair:

MP00292-1: 83192-4-PBS capture and 83192-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3974

Product name: Recombinant human SLC22A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-142 aa of BC028313

Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV

Predict reactive species
Full Name solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Calculated Molecular Weight 551 aa, 62 kDa
GenBank Accession NumberBC028313
Gene Symbol SLC22A4
Gene ID (NCBI) 6583
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H015
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...