OAT3/SLC22A8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OAT3/SLC22A8 Polyclonal antibody (16844-1-AP)

OAT3/SLC22A8 Polyclonal Antibody for WB, ELISA

Cat No. 16844-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SLC22A8, hOAT3, OAT3, Organic anion/dicarboxylate exchanger

• 

  WB analysis using 16844-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16844-1-AP (OAT3/SLC22A8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16844-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16844-1-AP (OAT3/SLC22A8 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16844-1-AP targets OAT3/SLC22A8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9795

  Product name: Recombinant human SLC22A8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-123 aa of bc022387

  Sequence: MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKE

• Full Name: solute carrier family 22 (organic anion transporter), member 8
• Calculated Molecular Weight: 542 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: bc022387
• Gene Symbol: SLC22A8
• Gene ID (NCBI): 9376
• RRID: AB_3663018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OAT3 (encoded by SLC22A8) is widely distributed in the kidney, liver, choroid plexus, olfactory mucosa, brain, retina, and placenta, but it is pre-dominantly expressed on the basolateral membrane of renal tubular cells. OAT3 plays a crucial role in the uptake, distribution, and excretion of various endogenous/exogenous substances.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse,human	WB	J Biol Chem; WWC1 upregulation accelerates hyperuricemia by reduction in renal uric acid excretion through Hippo signaling pathway.; Authors - Changshun Han
human	WB	Eur J Med Res; Molecular interplay between TXNIP and GLUT9 underlies uric acid transport dysregulation in vitro under hyperuricemic stress.; Authors - Yuqiu Zhu
		J Ethnopharmacol; The Pueraria lobata-Citrus reticulata decoction ameliorates hyperuricemia by modulating urate transporters and suppressing the PI3K/AKT/NF-κB pathway.; Authors - Lan Xu
		Pharmaceuticals (Basel); A Novel Dual URAT1/GLUT9 Inhibitor Reduces Hyperuricemia by Enhancing Uric Acid Excretion and Attenuating Renal Fibrosis.; Authors - Hailong Zhang
rat	WB	Naunyn Schmiedebergs Arch Pharmacol; Molecular mechanism of geniposide against ANIT-induced intrahepatic cholestasis by integrative analysis of transcriptomics and metabolomics; Authors - Junyi Zhang
rat,mouse,human	WB	Cell Rep Med; Phosphoglycerate kinase 1 contributes to diabetic kidney disease through enzyme-dependent and independent manners.; Authors - Hai-Jian Sun