SLC24A5 Polyclonal antibody

• 

  WB analysis using 27747-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27747-1-AP (SLC24A5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 27747-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 27747-1-AP (SLC24A5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 27747-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27747-1-AP (SLC24A5 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 27747-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 27747-1-AP (SLC24A5 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SLC24A5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27747-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

JSX, NCKX5, SHEP4, SLC24A5

---

Tested Applications

• Positive WB detected in: mouse eye tissue, A375 cells, rat eye tissue
• Positive IHC detected in: human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• IHC: See 2 publications below

Product Information

27747-1-AP targets SLC24A5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24254

  Product name: Recombinant human SLC24A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 412-500 aa of BC113628

  Sequence: LCLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGNNKIRGCGG

• Full Name: solute carrier family 24, member 5
• Calculated Molecular Weight: 500 aa, 55 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC113628
• Gene Symbol: SLC24A5
• Gene ID (NCBI): 283652
• RRID: AB_2880959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q71RS6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Lab Invest; Nuclear receptor binding factor 2 (NRBF2) is required for learning and memory.; Authors - Xiaosen Ouyang
mouse	IHC	Pigment Cell Melanoma Res; Impact of a SLC24A5 variant on the retinal pigment epithelium of a Japanese patient with oculocutaneous albinism type 6.; Authors - Toru Saito ; KO Validated