SLC25A1 Polyclonal antibody

• 

  WB analysis using 15235-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15235-1-AP (SLC25A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15235-1-AP

  WB result of SLC25A1 antibody (15235-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A1 transfected HeLa cells.

• 

  WB analysis of rat liver using 15235-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15235-1-AP (SLC25A1 Antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 15235-1-AP

  IP result of anti-SLC25A1 (IP:15235-1-AP, 4ug; Detection:15235-1-AP 1:5000) with HeLa cells lysate 1400 ug.

• 

  IHC staining of human breast cancer using 15235-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15235-1-AP (SLC25A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15235-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15235-1-AP (SLC25A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 15235-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15235-1-AP (SLC25A1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 15235-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15235-1-AP (SLC25A1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 15235-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15235-1-AP (SLC25A1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 15235-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15235-1-AP (SLC25A1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 15235-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 15235-1-AP (SLC25A1 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 15235-1-AP

  Immunofluorescent analysis of HepG2 cells using 15235-1-AP (SLC25A1 Antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SLC25A1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15235-1-AP

Publications(35)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CIC, Citrate transport protein, CTP, SLC20A3, Tricarboxylate carrier protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, NCI-H1299 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human lung cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 32 publications below
• IHC: See 6 publications below
• IF: See 4 publications below
• IP: See 1 publications below

Product Information

15235-1-AP targets SLC25A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7352

  Product name: Recombinant human SLC25A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-311 aa of BC004980

  Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD

• Full Name: solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC004980
• Gene Symbol: SLC25A1
• Gene ID (NCBI): 6576
• RRID: AB_2254794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53007
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; A non-canonical tricarboxylic acid cycle underlies cellular identity.; Authors - Paige K Arnold
		Circulation; Glycolytic Switch Is Required for Transdifferentiation to Endothelial Lineage.; Authors - Li Lai
mouse	WB,IP	Nat Commun; IL-1R-IRAKM-Slc25a1 signaling axis reprograms lipogenesis in adipocytes to promote diet-induced obesity in mice.; Authors - Weiwei Liu
mouse	WB	EMBO J; Proline biosynthesis is a vent for TGFβ-induced mitochondrial redox stress.; Authors - Simon Schwörer
human	WB	Am J Hum Genet; Deficiency in SLC25A1, encoding the mitochondrial citrate carrier, causes combined D-2- and L-2-hydroxyglutaric aciduria.; Authors - Benjamin Nota
mouse,human	WB,IHC	Cell Death Differ; Inhibition of the mitochondrial citrate carrier, Slc25a1, reverts steatosis, glucose intolerance, and inflammation in preclinical models of NAFLD/NASH.; Authors - Mingjun Tan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Bruna (Verified Customer) (03-05-2022)

This ab works very well for WB in human and mouse cell lines. Very strong and specific band (tested with KO cells lines).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: MEFs/U2OS

FH

Chunling (Verified Customer) (12-06-2018)

This antibody works great for western blot and Immunofluorescence. It is very specific with no non specific bands in western.

• Applications: Western Blot, Immunofluorescence,
• Cell Tissue Type: kidney cancer cells