Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, NCI-H1299 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human lung cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15235-1-AP targets SLC25A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7352 Product name: Recombinant human SLC25A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-311 aa of BC004980 Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 30-34 kDa |
| GenBank Accession Number | BC004980 |
| Gene Symbol | SLC25A1 |
| Gene ID (NCBI) | 6576 |
| RRID | AB_2254794 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P53007 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| IHC protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| IP protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| WB protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC25A1 Polyclonal antibody (Cat# 15235-1-AP) has 51 citations. These appear in high-impact journals including Nature, Cell, Cell Metabolism, Nature Communications, Science, EMBO Journal, Cell Death & Differentiation, Circulation, Science Advances, and others. Research fields span mitochondrial metabolism, the TCA/citrate cycle, lipid metabolism, NAFLD/NASH, cancer (colorectal, liver, glioma, esophageal, thyroid), ferroptosis, metabolic reprogramming, and developmental biology.
| Species | Application | Title |
|---|---|---|
Circulation Glycolytic Switch Is Required for Transdifferentiation to Endothelial Lineage. | ||
Cell Metab A hierarchical hepatic de novo lipogenesis substrate supply network utilizing pyruvate, acetate, and ketones | ||
Nat Commun IL-1R-IRAKM-Slc25a1 signaling axis reprograms lipogenesis in adipocytes to promote diet-induced obesity in mice. |
Reviews
What customers say
Both reviewers gave this antibody a 5-star rating. One user reported excellent Western Blot performance in human and mouse cell lines, noting a strong, specific band confirmed with knockout cell lines at a 1:1000 dilution. The other user praised its performance in both Western Blot and Immunofluorescence, highlighting high specificity with no non-specific bands observed in kidney cancer cells. Overall, users consistently report strong signal, high specificity, and reliable results across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bruna (Verified Customer) (03-05-2022) | This ab works very well for WB in human and mouse cell lines. Very strong and specific band (tested with KO cells lines).
|
Chunling (Verified Customer) (12-06-2018) | This antibody works great for western blot and Immunofluorescence. It is very specific with no non specific bands in western.
|
