• Featured Product
  • KD/KO Validated

SLC25A10 Polyclonal antibody

SLC25A10 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 12086-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

DIC, Solute carrier family 25 member 10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A549 cells, mouse liver tissue, mouse kidney tissue, HepG2 cells, PC-3 cells
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman lung tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12086-1-AP targets SLC25A10 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2719

Product name: Recombinant human SLC25A10 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-296 aa of BC015797

Sequence: MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAAAGDEPPPQGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS

Predict reactive species
Full Name solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Calculated Molecular Weight 296 aa, 32 kDa
Observed Molecular Weight 29-31 kDa
GenBank Accession NumberBC015797
Gene Symbol SLC25A10
Gene ID (NCBI) 1468
RRIDAB_10859816
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UBX3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A10, also known as dicarboxylate ion carrier (DIC), is a mitochondrial inner membrane carrier protein which catalyzes the transport of dicarboxylates such as malate and succinate across the mitochondrial membrane in exchange for phosphate, sulfate, and thiosulfate. SLC25A10 is expressed at highest levels in kidney and liver, lower levels in lung, spleen, heart, and brain, and lowest levels in skeletal muscle. Two isoforms of SLC25A10 exist due to the alternative splicing.

Protocols

Product Specific Protocols
IF protocol for SLC25A10 antibody 12086-1-APDownload protocol
IHC protocol for SLC25A10 antibody 12086-1-APDownload protocol
IP protocol for SLC25A10 antibody 12086-1-APDownload protocol
WB protocol for SLC25A10 antibody 12086-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Hum Cell

The role of PYCR1 in inhibiting 5-fluorouracil-induced ferroptosis and apoptosis through SLC25A10 in colorectal cancer

Authors - Borong Zhou
humanWB,IHC

Oncol Lett

SLC25A10 performs an oncogenic role in human osteosarcoma.

Authors - Gaoyuan Wang
  • KD Validated
rat,humanWB,IHC,IF

J Cardiovasc Transl Res

Mild Therapeutic Hypothermia Alleviated Myocardial Ischemia/Reperfusion Injury via Targeting SLC25A10 to Suppress Mitochondrial Apoptosis

Authors - Senlin Ma
humanWB,CoIP

Cell Death Discov

Mitochondrial SLC25A10 promotes prostate cancer progression by inhibiting ferritinophagy

Authors - Guopeng Yu
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Pooja (Verified Customer) (09-08-2025)

Worked well with mouse retina at a dilution of 1:100, incubated overnight at 4 degree.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse retina
SLC25A10 Antibody Immunohistochemistry validation (1:100 dilution) in Mouse retina (Cat no:12086-1-AP)
FH

Pooja (Verified Customer) (07-21-2025)

Works well in 3% BSA at a dilution of 1:100 incubation for overnight at 4 degree, got better results in mouse and rat retina cryosections.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse and rat retina cryosections
Loading...
||
New chat Able
正在加载,请稍候...