UCP4 Polyclonal antibody

• 

UCP4 Polyclonal Antibody for ELISA

Cat No. 17010-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

SLC25A27, UCP 4, UCP4

---

Product Information

17010-1-AP targets UCP4 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10715

  Product name: Recombinant human SLC25A27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-245 aa of BC033091

  Sequence: MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLVNPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ

• Full Name: solute carrier family 25, member 27
• Calculated Molecular Weight: 245aa,27 kDa; 323aa,36 kDa
• GenBank Accession Number: BC033091
• Gene Symbol: UCP4
• Gene ID (NCBI): 9481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95847
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.