SLC25A34 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC25A34 Polyclonal antibody (17557-1-AP)

SLC25A34 Polyclonal Antibody for WB, IP, ELISA

Cat No. 17557-1-AP Copied!

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

RP11 169K16.2

• 

  WB analysis of HepG2 using 17557-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17557-1-AP (SLC25A34 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 17557-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 17557-1-AP (SLC25A34 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 17557-1-AP

  IP result of anti-SLC25A34 (IP:17557-1-AP, 4ug; Detection:17557-1-AP 1:500) with HepG2 cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC25A34 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, human liver tissue
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17557-1-AP targets SLC25A34 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11719

  Product name: Recombinant human SLC25A34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC027998

  Sequence: METVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAVAGALGAFVGSPAYLIKTQLQAQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQHKGT

• Full Name: solute carrier family 25, member 34
• Calculated Molecular Weight: 304 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC027998
• Gene Symbol: SLC25A34
• Gene ID (NCBI): 284723
• RRID: AB_2190178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PIV7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for 17557-1-AP is a 5-star rating. The customer used the antibody for Western Blot on mouse tissue samples at a 1:1000 dilution and noted that it works well even at high dilution. Overall, the feedback is positive, highlighting the antibody's strong performance and sensitivity in WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Gaurav (Verified Customer) (03-20-2026)

Works on high dilution

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse Tissue Samples