SLC25A41 Polyclonal antibody

• 

  IHC staining of human liver using 17437-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17437-1-AP (SLC25A41 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 17437-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17437-1-AP (SLC25A41 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC25A41 Polyclonal Antibody for IHC, ELISA

Cat No. 17437-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

Small calcium-binding mitochondrial carrier protein 3-like, SCaMC-3L, Mitochondrial carrier protein SCaMC-3L, Mitochondrial ATP-Mg/Pi carrier protein SLC25A41

---

Tested Applications

• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17437-1-AP targets SLC25A41 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11508

  Product name: Recombinant human SLC25A41 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-251 aa of BC031671

  Sequence: MQVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGIQGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVVYEAMKKTLGI

• Full Name: solute carrier family 25, member 41
• Calculated Molecular Weight: 251 aa, 28 kDa
• GenBank Accession Number: BC031671
• Gene Symbol: SLC25A41
• Gene ID (NCBI): 284427
• RRID: AB_3669274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5S1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 25 member 41 (SLC25A41), also known as SCaMC-3-like, belongs to the mitochondrial carrier (TC 2.A.29) family. SLC25A41 lacks the Ca2+-binding N-extension. SLC25A41 represents a novel mechanism involved in adenine nucleotide transport across the inner mitochondrial membrane different to ADP/ATP translocases or long SCaMC paralogues (PMID: 18928449).