SLC25A45 Polyclonal antibody

SLC25A45 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 14160-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Solute carrier family 25 member 45

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, SH-SY5Y cells
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14160-1-AP targets SLC25A45 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5342

Product name: Recombinant human SLC25A45 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 97-335 aa of BC041100

Sequence: DLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGLCRHCFLGGSHALRRDQVPDADGWTETQSVPGDAGLHGEQHPAGRTGSLLPGGHHQQCPRLSRQCCHLPQLRISPPLVGMSPAAMPAAPHQAHGLEASLRLEARLKACKSVQEAQPFLTKVPPTRADLGWADTCGSRKPGACAASLCSWP

Predict reactive species
Full Name solute carrier family 25, member 45
Calculated Molecular Weight 335 aa, 36 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC041100
Gene Symbol SLC25A45
Gene ID (NCBI) 283130
RRIDAB_2190339
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N413
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A45 (solute carrier family 25 member 45) is a mitochondrial inner membrane transporter recently identified as essential for the import of methylated amino acids. Dias et al. (2025, Molecular Cell) demonstrated that SLC25A45 specifically mediates the mitochondrial uptake of dimethylarginine and trimethyllysine, but not their unmethylated counterparts. This selective transport enables mitochondria to metabolize trimethyllysine for de novo carnitine biosynthesis, linking SLC25A45 activity to fatty acid oxidation and methylated amino acid homeostasis. A naturally occurring human variant, R285C, enhances SLC25A45 stability by disrupting m-AAA protease-dependent degradation and is associated with altered plasma levels of methylated amino acids and deoxycarnitine. Functionally, SLC25A45 defines a key metabolic node coordinating methylated amino acid turnover, carnitine synthesis, and mitochondrial signaling, implicating it in cardiovascular, renal, and metabolic pathophysiology. (PMID: 41075794)

Protocols

Product Specific Protocols
IF protocol for SLC25A45 antibody 14160-1-APDownload protocol
WB protocol for SLC25A45 antibody 14160-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...