SLC25A45 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 14160-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14160-1-AP (SLC25A45 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 14160-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 14160-1-AP (SLC25A45 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 14160-1-AP

  Immunofluorescent analysis of SH-SY5Y cells using 14160-1-AP (SLC25A45 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SLC25A45 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14160-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Solute carrier family 25 member 45

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, SH-SY5Y cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14160-1-AP targets SLC25A45 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5342

  Product name: Recombinant human SLC25A45 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-335 aa of BC041100

  Sequence: DLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGLCRHCFLGGSHALRRDQVPDADGWTETQSVPGDAGLHGEQHPAGRTGSLLPGGHHQQCPRLSRQCCHLPQLRISPPLVGMSPAAMPAAPHQAHGLEASLRLEARLKACKSVQEAQPFLTKVPPTRADLGWADTCGSRKPGACAASLCSWP

• Full Name: solute carrier family 25, member 45
• Calculated Molecular Weight: 335 aa, 36 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC041100
• Gene Symbol: SLC25A45
• Gene ID (NCBI): 283130
• RRID: AB_2190339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N413
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A45 (solute carrier family 25 member 45) is a mitochondrial inner membrane transporter recently identified as essential for the import of methylated amino acids. Dias et al. (2025, Molecular Cell) demonstrated that SLC25A45 specifically mediates the mitochondrial uptake of dimethylarginine and trimethyllysine, but not their unmethylated counterparts. This selective transport enables mitochondria to metabolize trimethyllysine for de novo carnitine biosynthesis, linking SLC25A45 activity to fatty acid oxidation and methylated amino acid homeostasis. A naturally occurring human variant, R285C, enhances SLC25A45 stability by disrupting m-AAA protease-dependent degradation and is associated with altered plasma levels of methylated amino acids and deoxycarnitine. Functionally, SLC25A45 defines a key metabolic node coordinating methylated amino acid turnover, carnitine synthesis, and mitochondrial signaling, implicating it in cardiovascular, renal, and metabolic pathophysiology. (PMID: 41075794)