SLC25A46 Polyclonal antibody

• 

  WB analysis of mouse brain using 27869-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27869-1-AP (SLC25A46 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 27869-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27869-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 27869-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27869-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human medulloblastoma using 27869-1-AP

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma tissue slide using 27869-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human medulloblastoma using 27869-1-AP

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma tissue slide using 27869-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 27869-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using 27869-1-AP (SLC25A46 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SLC25A46 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27869-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Mitochondrial outer membrane protein SLC25A46, TB1

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human colon tissue, human medulloblastoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

This antibody is only recommended for WB detection of tissue samples.

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27869-1-AP targets SLC25A46 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27293

  Product name: Recombinant human SLC25A46 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 222-382 aa of BC017169

  Sequence: IETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIRQEEGV

• Full Name: solute carrier family 25, member 46
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017169
• Gene Symbol: SLC25A46
• Gene ID (NCBI): 91137
• RRID: AB_2880999
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 25 member 46 (SLC25A46), a highly conserved protein among various species including vertebrates, is a nuclear gene encoding mitochondrial carriers. SLC25A46 is involved in mitochondrial fission and the transport of lipids from the endoplasmic reticulum to mitochondria (PMID: 33277645). SLC25A46 has 3 isoforms with molecular weights of 30, 37 and 46 kDa, respectively.