SLC26A11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC26A11 Polyclonal antibody, PBS Only (14156-1-PBS)

• 

  WB analysis using 14156-1-AP (same clone as 14156-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14156-1-AP (SLC26A11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 14156-1-AP (same clone as 14156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14156-1-AP (SLC26A11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 14156-1-AP (same clone as 14156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14156-1-AP (SLC26A11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14156-1-PBS in a different storage buffer formulation.

SLC26A11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14156-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14156-1-PBS targets SLC26A11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5338

  Product name: Recombinant human SLC26A11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 463-606 aa of BC035900

  Sequence: MLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQKPGTQPYNIREDSILDQKVALLKA

• Full Name: solute carrier family 26, member 11
• Calculated Molecular Weight: 606 aa, 65 kDa
• Observed Molecular Weight: 65-72 kDa
• GenBank Accession Number: BC035900
• Gene Symbol: SLC26A11
• Gene ID (NCBI): 284129
• RRID: AB_3085430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WA9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC26A11 is a sodium-independent sulfate transporter from high endothelial venules (PMID: 12626430). SLC26A11 exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC) (PMID: 12626430). SLC26A11 is critical for inhibitory transmission and contributes to locomotor coordination in Purkinje cells (PMID: 27390771). SLC26A11, a chloride transporter, localizes with the vacuolar H+-ATPase of A-intercalated cells of the kidney and can be detected at 72kDa (PMID: 21716257).