SLC26A3 Polyclonal antibody

SLC26A3 Polyclonal Antibody for IHC, ELISA
Cat No. 13165-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

DRA, Down-regulated in adenoma, CLD, Chloride anion exchanger

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse testis tissue, human colon tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13165-1-AP targets SLC26A3 in IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3816

Product name: Recombinant human SLC26A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 497-764 aa of BC025671

Sequence: LTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF

Predict reactive species
Full Name solute carrier family 26, member 3
Calculated Molecular Weight 764 aa, 85 kDa
Observed Molecular Weight84 kDa
GenBank Accession NumberBC025671
Gene Symbol SLC26A3
Gene ID (NCBI) 1811
RRIDAB_3669154
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40879
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC26A3 (Chloride anion exchanger), also known as DRA. It is expected to be located in the cytoplasm and cell membranes. It is a transmembrane glycoprotein, which is mainly located in the lower digestive tract mucosa, especially in the apical membrane of columnar epithelium and some goblet cells. The expression level of SLC26A3 in intestine is different along different parts of intestine, and there are also differences on crypt-villus axis. It is mainly expressed in the apical membrane of colon epithelial cells, less in jejunum and ileum, but not in esophagus. It participates in the absorption of electrically neutral NaCl in intestine and works with Na+/H+ exchanger. Cl-/HCO3- exchange mediated by SLC26A3 is very important for maintaining intestinal acid-base balance. In duodenum, the physiological function of SLC26A3 is related to HCO3- secretion, which plays a central role in neutralizing gastric acid (PMID: 32989468). The molecular weight of SLC26A3 is 84 kDa.

Protocols

Product Specific Protocols
IHC protocol for SLC26A3 antibody 13165-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...