SLC26A4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC26A4 Polyclonal antibody, PBS Only (22726-1-PBS)

• 

  WB analysis of A549 using 22726-1-AP (same clone as 22726-1-PBS)

  37°C incubated A549 cells were subjected to SDS PAGE followed by western blot with 22726-1-AP (SLC26A4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22726-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 22726-1-AP (same clone as 22726-1-PBS)

  IP result of anti-SLC26A4 (IP:22726-1-AP, 4ug; Detection:22726-1-AP 1:500) with mouse kidney tissue lysate 4800ug. This data was developed using the same antibody clone with 22726-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 22726-1-AP (same clone as 22726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 22726-1-AP (SLC26A4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22726-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 22726-1-AP (same clone as 22726-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 22726-1-AP (SLC26A4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22726-1-PBS in a different storage buffer formulation.

SLC26A4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 22726-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

DFNB4, EVA, PDS, Pendrin

---

Product Information

22726-1-PBS targets SLC26A4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18622

  Product name: Recombinant human SLC26A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 517-646 aa of BC153002

  Sequence: SWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPV

• Full Name: solute carrier family 26, member 4
• Calculated Molecular Weight: 780 aa, 86 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC153002
• Gene Symbol: SLC26A4
• Gene ID (NCBI): 5172
• RRID: AB_3742079
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43511
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC26A4 encodes an 86-kDa transmembrane protein named pendrin with up to 15 predicted membrane-spanning domains (PMID: 22116369). SLC26A4 is necessary for normal reabsorption of endolymph, the fluid bathing the inner ear. (PMID: 31599023, PMID: 39383236). In the endolymphatic sac, where fluid reabsorption occurs, SLC26A4 is localized along the apical microvilli of mitochondria-rich cells, in contact with the endolymph, and associated with clathrin-coated pits where μ2 and AP-2 are present (PMID: 39383236). SLC26A4 encodes an anion transporter transmembrane protein, pendrin, which is expressed in the thyroid, kidney, and cochlea (PMID: 23185506).