SLC2A13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC2A13 Polyclonal antibody, PBS Only (13848-1-PBS)

• 

  WB analysis using 13848-1-AP (same clone as 13848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13848-1-AP (SLC2A13 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13848-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13848-1-AP (same clone as 13848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13848-1-AP (SLC2A13 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13848-1-PBS in a different storage buffer formulation.

SLC2A13 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13848-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, Indirect ELISA

Synonyms

Solute carrier family 2 member 13, Proton myo-inositol cotransporter, Hmit, H(+)-myo-inositol symporter, H(+)-myo-inositol cotransporter

---

Product Information

13848-1-PBS targets SLC2A13 in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4818

  Product name: Recombinant human SLC2A13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 243-338 aa of BC047507

  Sequence: SPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYVFLSGFLLKRL

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 13
• Calculated Molecular Weight: 629 aa, 70 kDa
• Observed Molecular Weight: 75~90 kDa
• GenBank Accession Number: BC047507
• Gene Symbol: SLC2A13
• Gene ID (NCBI): 114134
• RRID: AB_3741845
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QE2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMIT is a glycosylated protein containing three conserved internalization signals: an ER retention signal and a dileucine internalization signal in the N-terminal region and a tyrosine-based internalization motif at the C-terminus.