Product Information
13848-1-PBS targets SLC2A13 in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4818 Product name: Recombinant human SLC2A13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 243-338 aa of BC047507 Sequence: SPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYVFLSGFLLKRL Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 13 |
| Calculated Molecular Weight | 629 aa, 70 kDa |
| Observed Molecular Weight | 75~90 kDa |
| GenBank Accession Number | BC047507 |
| Gene Symbol | SLC2A13 |
| Gene ID (NCBI) | 114134 |
| RRID | AB_3741845 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96QE2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
HMIT is a glycosylated protein containing three conserved internalization signals: an ER retention signal and a dileucine internalization signal in the N-terminal region and a tyrosine-based internalization motif at the C-terminus.



