SLC30A2 Monoclonal antibody, PBS Only

SLC30A2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67993-1-PBS
Clone No.1D9E5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, IHC, Indirect ELISA

FLJ36708, PP12488, SLC30A2, Zinc transporter 2, ZnT 2, ZNT2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67993-1-PBS targets SLC30A2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8232

Product name: Recombinant human SLC30A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 234-323 aa of BC006251

Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD

Predict reactive species
Full Name solute carrier family 30 (zinc transporter), member 2
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight41 kDa
GenBank Accession NumberBC006251
Gene Symbol SLC30A2
Gene ID (NCBI) 7780
RRIDAB_2918742
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BRI3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and functions as a homo- or hetero- dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 and 41 kDa.

Loading...
||
New chat Able
正在加载,请稍候...