ZnT7 Polyclonal antibody

• 

  WB analysis using 13966-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13966-1-AP (ZnT7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 13966-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13966-1-AP (ZnT7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 13966-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13966-1-AP (ZnT7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 13966-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13966-1-AP (ZnT7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 13966-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13966-1-AP (ZnT7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 13966-1-AP

  Immunofluorescent analysis of A431 cells, using SLC30A7 antibody 13966-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

ZnT7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13966-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SLC30A7, ZnT 7, ZnT-7, ZNTL2, Znt-like transporter 2

---

Tested Applications

• Positive WB detected in: C2C12 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 11 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

13966-1-AP targets ZnT7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4957

  Product name: Recombinant human SLC30A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 287-376 aa of BC064692

  Sequence: RESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM

• Full Name: solute carrier family 30 (zinc transporter), member 7
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC064692
• Gene Symbol: SLC30A7
• Gene ID (NCBI): 148867
• RRID: AB_2189776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEW0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Neuropathol Commun; Deregulation of subcellular biometal homeostasis through loss of the metal transporter, Zip7, in a childhood neurodegenerative disorder.; Authors - Alexandra Grubman
mouse	WB	Metallomics; Deregulation of biometal homeostasis: the missing link for neuronal ceroid lipofuscinoses?; Authors - Alexandra Grubman
rat	WB	Am J Physiol Gastrointest Liver Physiol; Zinc deficiency mediates alcohol-induced apoptotic cell death in the liver of rats through activating ER and mitochondrial cell death pathways.; Authors - Qian Sun
mouse	WB	Am J Physiol Gastrointest Liver Physiol; Dysregulation of hepatic zinc transporters in a mouse model of alcoholic liver disease.; Authors - Qian Sun
chicken	WB	Front Physiol; Organic zinc with moderate chelation strength enhances zinc absorption in the small intestine and expression of related transporters in the duodenum of broilers; Authors - Yun Hu
chicken	WB	J Anim Sci; Zinc proteinate with moderate chelation strength enhances zinc absorption by upregulating the expression of zinc and amino acid transporters in primary cultured duodenal epithelial cells of broiler embryos; Authors - Yun Hu