SLC31A1 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83844-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83844-3-PBS against Human SLC31A1 was performed. The affinity constant is 1.26 nM.

SLC31A1 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83844-3-PBS

Clone No.240868C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

COPT1, CTR1, Truncated CTR1 form

---

Product Information

83844-3-PBS targets SLC31A1 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26601

  Product name: Recombinant human SLC31A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-67 aa of BC013611

  Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

• Full Name: solute carrier family 31 (copper transporters), member 1
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC013611
• Gene Symbol: SLC31A1
• Gene ID (NCBI): 1317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15431
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.