SLC31A1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 83844-5-RR (same clone as 83844-5-PBS)

  WB result of SLC31A1 antibody (83844-5-RR; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC31A1 transfected HeLa cells. This data was developed using the same antibody clone with 83844-5-PBS in a different storage buffer formulation.

• 

  WB analysis of SW480 using 83844-5-RR (same clone as 83844-5-PBS)

  WB result of SLC31A1 antibody (83844-5-RR; 1:800; room temperature for 1.5 hours) with wild-type and SLC31A1 knockout SW480 cells. This data was developed using the same antibody clone with 83844-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 83844-5-RR (same clone as 83844-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83844-5-RR (SLC31A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83844-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83844-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83844-5-RR against Human SLC31A1 were performed. The affinity constant is 3.33 nM.

• Featured Product
• KD/KO Validated

SLC31A1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83844-5-PBS

Clone No.240868D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

COPT1, 240868D10, CTR1, Truncated CTR1 form

---

Product Information

83844-5-PBS targets SLC31A1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26601

  Product name: Recombinant human SLC31A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-67 aa of BC013611

  Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

• Full Name: solute carrier family 31 (copper transporters), member 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-23 kDa
• GenBank Accession Number: BC013611
• Gene Symbol: SLC31A1
• Gene ID (NCBI): 1317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O15431
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356).