SLC31A1 Monoclonal antibody

• 

  WB analysis of HepG2 using 67221-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67221-1-Ig (SLC31A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67221-1-Ig

  WB result of SLC31A1 antibody (67221-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC31A1 transfected HeLa cells.

• 

  WB analysis of HeLa using 67221-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67221-1-Ig (SLC31A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67221-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67221-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67221-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67221-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human liver cancer using 67221-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human liver cancer using 67221-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

SLC31A1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67221-1-Ig

Clone No.1A4H5

Publications(18)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

COPT1, 1A4H5, CTR1, Truncated CTR1 form

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 13 publications below
• IHC: See 6 publications below
• IF: See 4 publications below

Product Information

67221-1-Ig targets SLC31A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28410

  Product name: Recombinant human SLC31A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-67 aa of BC013611

  Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

• Full Name: solute carrier family 31 (copper transporters), member 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC013611
• Gene Symbol: SLC31A1
• Gene ID (NCBI): 1317
• RRID: AB_2882512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15431
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Mol Biosci; Significance of cuproptosis- related genes in the diagnosis and classification of psoriasis; Authors - Qingyuan Lin
human	WB	J Virol; Identification of Copper Transporter 1 as a Receptor for Feline Endogenous Retrovirus ERV-DC14.; Authors - Sandrine Tury ; KD Validated
human	WB	Mol Biol Cell; Adaptive protein synthesis in genetic models of copper deficiency and childhood neurodegeneration; Authors - Alicia R Lane
human	WB,IF	Front Immunol; Plasma IgG and IgM autoantibodies to COPT1 as potential biomarkers for detection of non-small cell lung cancer; Authors - Xiaobin Cao
human	WB,IF	BMC Cancer; Copper's new role in cancer: how cuproptosis-related genes could revolutionize glioma treatment; Authors - Yu Wang
human	IHC	Front Immunol; Identification of hub cuproptosis related genes and immune cell infiltration characteristics in periodontitis; Authors - Shuying Liu